Protein coding transcript 906

• Transcript: Ll_transcript_445094
• CDS coordinates: 2-316 (+)
• Peptide sequence: TDEEIEMLRHAVLKFGEELSQICEHIKGKTVSQIKSTLKKKVFEDAGLQVRQQIQATPTSINQQSQQSMMSREVTLNMLNATESEVDVEGLNEDVKLEFDGPTEE
• ORF Type: internal

Annotations of Ll_transcript_445094

• Blastp: Chromatin complexes subunit BAP18 from Mus with 34.33% of identity
• Blastx: Chromatin complexes subunit BAP18 from Mus with 34.65% of identity
• Eggnog: Chromosome 17 open reading frame 49(ENOG4111K4E)
• Kegg: Link to kegg annotations (104457)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006587316.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;