Protein coding transcript 90629

• Transcript: Ll_transcript_402067
• CDS coordinates: 289-777 (+)
• Peptide sequence: MASFPGNFAPLNGSIYVCNLPYGTDENMLAEYFGTIGLVKKDKRTGKPKIWLYRDKETNEPKGDATVTYEDPHAALAAVEWFNNKDFHGSTIGVYIAESKNKDEQAINPVGEPLVSDNIGVVEETLADVNGGSGRGRGRNETSGKAWKQDGDWMCTNTRSVI*
• ORF Type: complete

Annotations of Ll_transcript_402067

• Blastp: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 68.21% of identity
• Blastx: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 62.95% of identity
• Eggnog: Ewing sarcoma breakpoint region 1(ENOG4111Q2F)
• Kegg: Link to kegg annotations (AT1G50300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420606.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;