Protein coding transcript 90631

• Transcript: Ll_transcript_402070
• CDS coordinates: 957-1286 (+)
• Peptide sequence: MCGNINWAKRNKCNICNTNKPGTSEGGVRGGRAGGYKELDEEELEETKRRRREAEDDGELYDEFGNLKKKFRAKAQQTEAVRVLPGSGRASWEVEELGISCISIMVCSP*
• ORF Type: complete

Annotations of Ll_transcript_402070

• Blastp: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 77.23% of identity
• Blastx: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 64.19% of identity
• Eggnog: Ewing sarcoma breakpoint region 1(ENOG4111Q2F)
• Kegg: Link to kegg annotations (AT1G50300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460794.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;