Transcript | Ll_transcript_402070 |
---|---|
CDS coordinates | 957-1286 (+) |
Peptide sequence | MCGNINWAKRNKCNICNTNKPGTSEGGVRGGRAGGYKELDEEELEETKRRRREAEDDGELYDEFGNLKKKFRAKAQQTEAVRVLPGSGRASWEVEELGISCISIMVCSP* |
ORF Type | complete |
Blastp | Transcription initiation factor TFIID subunit 15 from Arabidopsis with 77.23% of identity |
---|---|
Blastx | Transcription initiation factor TFIID subunit 15 from Arabidopsis with 64.19% of identity |
Eggnog | Ewing sarcoma breakpoint region 1(ENOG4111Q2F) |
Kegg | Link to kegg annotations (AT1G50300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460794.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer