Protein coding transcript 90645

• Transcript: Ll_transcript_402095
• CDS coordinates: 329-817 (+)
• Peptide sequence: MASLPGKFAPSNGSIYVCNLPYGTDENMLAEYFGTIGLVKKDKRTGRPKIWLYRDKETNEPKGDATVTYEDPHAALAAVEWFNNKDFHGSTIGVYIAESKNKDDQTFNTVVEPLVSDNVGGVEETPADVNGGSGRGRGRNETSGKAWKQEGDWMCTNTRSVI*
• ORF Type: complete

Annotations of Ll_transcript_402095

• Blastp: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 71.81% of identity
• Blastx: Transcription initiation factor TFIID subunit 15 from Arabidopsis with 66.04% of identity
• Eggnog: Ewing sarcoma breakpoint region 1(ENOG4111Q2F)
• Kegg: Link to kegg annotations (AT1G50300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460794.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;