Transcript | Ll_transcript_402054 |
---|---|
CDS coordinates | 3-533 (+) |
Peptide sequence | PKPLNFTTRSTARVAATADGKTEAPTAKDEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDV* |
ORF Type | 5prime_partial |
Blastp | Photosystem I reaction center subunit II-2, chloroplastic from Arabidopsis with 84.09% of identity |
---|---|
Blastx | Photosystem I reaction center subunit II, chloroplastic from Cucumis with 94.56% of identity |
Eggnog | photosystem i(ENOG4111HAV) |
Kegg | Link to kegg annotations (AT1G03130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420801.1) |
Pfam | PsaD (PF02531.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer