Protein coding transcript 90655

• Transcript: Ll_transcript_402072
• CDS coordinates: 3-533 (+)
• Peptide sequence: PKPLNFTTRSTARVAATADGKTEAPTAKDEAPVGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_402072

• Blastp: Photosystem I reaction center subunit II-2, chloroplastic from Arabidopsis with 84.09% of identity
• Blastx: Photosystem I reaction center subunit II, chloroplastic from Cucumis with 94.56% of identity
• Eggnog: photosystem i(ENOG4111HAV)
• Kegg: Link to kegg annotations (AT1G03130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420801.1)
• Pfam: PsaD (PF02531.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;