Protein coding transcript 90656

• Transcript: Ll_transcript_402074
• CDS coordinates: 27-824 (+)
• Peptide sequence: MKVIHCNWLKPNIKLSRADSHHPSKIQKSLTNLCCTYYHSQHCVLSTTQSPLISMALATQASLFTSTLSATSKPSLPWKQPSTRSFITPKPLNFTTSPTLTITAATADEKTEAPLAKEEAPVGFTPPELDPSTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDV*
• ORF Type: complete

Annotations of Ll_transcript_402074

• Blastp: Photosystem I reaction center subunit II, chloroplastic from Cucumis with 77.93% of identity
• Blastx: Photosystem I reaction center subunit II, chloroplastic from Cucumis with 81.15% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101207214)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444546.1)
• Pfam: PsaD (PF02531.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;