Protein coding transcript 90678

• Transcript: Ll_transcript_403670
• CDS coordinates: 1-372 (+)
• Peptide sequence: QFFYEEQLHRMECMAQEPVLFEDILCQIIDMIGPENESFITLHDLKGGRLSGSIFNILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEEASNGSAEVWDESLEAPF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_403670

• Blastp: Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma from Arabidopsis with 92.74% of identity
• Blastx: Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma from Arabidopsis with 92.74% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XRBK)
• Kegg: Link to kegg annotations (AT5G28900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428390.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;