Transcript | Ll_transcript_403655 |
---|---|
CDS coordinates | 3-440 (+) |
Peptide sequence | SLEYWFKCIDLDGNGVLTRNELQFFYEEQLHRMECMAQEPVLFEDILCQIIDMIRSENESFITLHDLKGGKLSGSVFNILFNLNKFMAFETRDPFLIRQERENPTLTDWDRFAHREYIRLSMEEDVEEASNGSAEVWDESLEAPF* |
ORF Type | 5prime_partial |
Blastp | Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma from Arabidopsis with 91.1% of identity |
---|---|
Blastx | Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma from Arabidopsis with 91.1% of identity |
Eggnog | Protein phosphatase 2, regulatory subunit B(ENOG410XRBK) |
Kegg | Link to kegg annotations (AT5G28900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452924.1) |
Pfam | EF hand (PF13202.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer