Protein coding transcript 90736

• Transcript: Ll_transcript_404621
• CDS coordinates: 330-1004 (+)
• Peptide sequence: MASSSPFFDDIRSHSDIDPPQIEELTDVSELVNDPTQTALKPNGTVSSSVRELLECPVCLNAMYPPIHQCSNGHTICSGCKPRVHNRCPTCRHELGNIRCLALEKVAASLELPCKYQGFGCIGIYPYYSKLKHESQCAHRPYNCPYAGSECSVMGDIPYLVSHLKDDHKVDMHNGSTFNHRYVKSNPQEVENATWMLTVFSCFGQYFCLHFEAFQLGAAPVYIAF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_404621

• Blastp: E3 ubiquitin-protein ligase SINAT5 from Arabidopsis with 81.56% of identity
• Blastx: E3 ubiquitin-protein ligase SINAT5 from Arabidopsis with 81.56% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT5G53360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451036.1)
• Pfam: Seven in absentia protein family (PF03145.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;