Transcript | Ll_transcript_404621 |
---|---|
CDS coordinates | 330-1004 (+) |
Peptide sequence | MASSSPFFDDIRSHSDIDPPQIEELTDVSELVNDPTQTALKPNGTVSSSVRELLECPVCLNAMYPPIHQCSNGHTICSGCKPRVHNRCPTCRHELGNIRCLALEKVAASLELPCKYQGFGCIGIYPYYSKLKHESQCAHRPYNCPYAGSECSVMGDIPYLVSHLKDDHKVDMHNGSTFNHRYVKSNPQEVENATWMLTVFSCFGQYFCLHFEAFQLGAAPVYIAF |
ORF Type | 3prime_partial |
Blastp | E3 ubiquitin-protein ligase SINAT5 from Arabidopsis with 81.56% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase SINAT5 from Arabidopsis with 81.56% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G53360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451036.1) |
Pfam | Seven in absentia protein family (PF03145.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer