Protein coding transcript 90748

• Transcript: Ll_transcript_402779
• CDS coordinates: 132-464 (+)
• Peptide sequence: MEGGDEGVEMVVDSKDLQKQSKAFDKLTDRVEDRQLDSTRVQEAMASIAASAEADWNAMRLREKELAAVKINAADVDIIANELELDKKVAERTLREHKGDAVAAIRHLLH*
• ORF Type: complete

Annotations of Ll_transcript_402779

• Blastp: Huntingtin-interacting protein K from Mus with 36.59% of identity
• Blastx: Huntingtin-interacting protein K from Mus with 36.59% of identity
• Eggnog: huntingtin interacting protein K(ENOG4111M4G)
• Kegg: Link to kegg annotations (67693)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424737.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;