Protein coding transcript 90763

• Transcript: Ll_transcript_403326
• CDS coordinates: 318-632 (+)
• Peptide sequence: MLSTVFEGVFTPNDDLAKEIFDASEASGEKLWRLPLEDSYWESMKSGVADMVNTGGRQGGAITAALFLKQFVDEKVKWGHIDLAGPVWNDKKRSATGFGVATLVE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_403326

• Blastp: Leucine aminopeptidase 2, chloroplastic from Oryza sativa with 79.81% of identity
• Blastx: Leucine aminopeptidase 2, chloroplastic from Oryza sativa with 77.57% of identity
• Eggnog: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity)(COG0260)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415349.1)
• Pfam: Cytosol aminopeptidase family, catalytic domain (PF00883.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;