Protein coding transcript 90783

• Transcript: Ll_transcript_402616
• CDS coordinates: 194-526 (+)
• Peptide sequence: MSSNCVKRFGGRWVSLVSHRGFSTSSEQGLKSLNLFSAINQALHIALDTDPRAYVFGEDVSFGGVFRCTTGLADRFGKSRVFNTPLCEQVFMYFMLPLLFFSFSHSHSPM*
• ORF Type: complete

Annotations of Ll_transcript_402616

• Blastp: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 73.17% of identity
• Blastx: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 89.9% of identity
• Eggnog: Dehydrogenase, E1 component(COG0022)
• Kegg: Link to kegg annotations (AT1G55510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448466.1)
• Pfam: Transketolase, pyrimidine binding domain (PF02779.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;