Transcript | Ll_transcript_402603 |
---|---|
CDS coordinates | 1522-1914 (+) |
Peptide sequence | MLPLSEAEVVRQGSDITLVGWGAQLAIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIVERCFSRLEAPVARVCGLDTPFPLVFEPFYMPNKNKILDAIKS |
ORF Type | 3prime_partial |
Blastp | 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 90.08% of identity |
---|---|
Blastx | 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 90.34% of identity |
Eggnog | Dehydrogenase, E1 component(COG0022) |
Kegg | Link to kegg annotations (AT1G55510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448466.1) |
Pfam | Transketolase, C-terminal domain (PF02780.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer