Protein coding transcript 90787

• Transcript: Ll_transcript_402604
• CDS coordinates: 1562-1891 (+)
• Peptide sequence: MLPLSEAEVVRQGSDITLVGWGAQLAIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIVERCFSRVCSNLYVYNLACCP*
• ORF Type: complete

Annotations of Ll_transcript_402604

• Blastp: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 84.62% of identity
• Blastx: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 86% of identity
• Eggnog: Dehydrogenase, E1 component(COG0022)
• Kegg: Link to kegg annotations (AT1G55510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448466.1)
• Pfam: Transketolase, C-terminal domain (PF02780.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;