Protein coding transcript 90788

• Transcript: Ll_transcript_402606
• CDS coordinates: 1562-1954 (+)
• Peptide sequence: MLPLSEAEVVRQGSDITLVGWGAQLAIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIVERCFSRLEAPVARVCGLDTPFPLVFEPFYMPNKNKILDAIKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_402606

• Blastp: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 90.08% of identity
• Blastx: 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 90.34% of identity
• Eggnog: Dehydrogenase, E1 component(COG0022)
• Kegg: Link to kegg annotations (AT1G55510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448466.1)
• Pfam: Transketolase, C-terminal domain (PF02780.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;