Transcript | Ll_transcript_402608 |
---|---|
CDS coordinates | 824-1570 (+) |
Peptide sequence | MGNRAIAEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPRQAKGLLLSCIRDPNPVVFFEPKWLYRLAVEEVPEDEYMLPLSEAEVVRQGSDITLVGWGAQLAIMEQACLDAEKEGISCELIDLKTLIPWDKETVEASVKKTGRLLISHEAPVTGGFGAEISASIVERCFSRLEAPVARVCGLDTPFPLVFEPFYMPNKNKILDAIKS |
ORF Type | 3prime_partial |
Blastp | 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 92.77% of identity |
---|---|
Blastx | 2-oxoisovalerate dehydrogenase subunit beta 1, mitochondrial from Arabidopsis with 93.08% of identity |
Eggnog | Dehydrogenase, E1 component(COG0022) |
Kegg | Link to kegg annotations (AT1G55510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448466.1) |
Pfam | Transketolase, pyrimidine binding domain (PF02779.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer