Protein coding transcript 90792

• Transcript: Ll_transcript_402625
• CDS coordinates: 510-842 (+)
• Peptide sequence: MCRFLGHGAEYDKGTPSLPKILLVQGAGGIIAGATSSFVTTPLDTIKTRLQVMSHEKRSTVKQVVKDLVNEDGWKGFYRGFGPRFFSMSAWGTSMILTYEYLKRLCTIDE*
• ORF Type: complete

Annotations of Ll_transcript_402625

• Blastp: Mitochondrial coenzyme A transporter SLC25A42 from Danio with 32.61% of identity
• Blastx: Mitochondrial substrate carrier family protein P from Dictyostelium with 33.8% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (751743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456598.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;