Transcript | Ll_transcript_402635 |
---|---|
CDS coordinates | 319-651 (+) |
Peptide sequence | MCRFLGHGAEYDKGTPSLPKILLVQGAGGIIAGATSSFVTTPLDTIKTRLQVMSHEKRSTVKQVVKDLVNEDGWKGFYRGFGPRFFSMSAWGTSMILTYEYLKRLCTIDE* |
ORF Type | complete |
Blastp | Mitochondrial coenzyme A transporter SLC25A42 from Danio with 32.61% of identity |
---|---|
Blastx | Mitochondrial substrate carrier family protein P from Dictyostelium with 33.8% of identity |
Eggnog | Solute carrier family 25(ENOG410ZRF1) |
Kegg | Link to kegg annotations (751743) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456598.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer