| Transcript | Ll_transcript_403418 |
|---|---|
| CDS coordinates | 195-596 (+) |
| Peptide sequence | MESALFRPCYVPLFLQPNDLRSNITSSIRYTSTIFCSSRNQSYIPKLEPFSRTKFDRIVKDPPLIQKSEKEIADYCSTLEGDECCSCWQAYFELKDLEKESPKADIERLILQTGGVKSLIGCLHGVAIMHKMKN |
| ORF Type | 3prime_partial |
| Blastp | CCG-binding protein 1 from Arabidopsis with 55.73% of identity |
|---|---|
| Blastx | CCG-binding protein 1 from Arabidopsis with 55.73% of identity |
| Eggnog | NA(ENOG41123WT) |
| Kegg | Link to kegg annotations (AT2G15890) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424239.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer