Protein coding transcript 90914

• Transcript: Ll_transcript_402258
• CDS coordinates: 3-575 (+)
• Peptide sequence: LKQFELGVGTLLQLYFSIFNELKLLLPDILNFFSVTSFGDNGLDMRFSNPLYLRAVLEDKRYSKCRFVLLHASYPFSREASYLASIHPQVYLDFGLAIPKLSVHGMISSVKELIELAPLSKVMFSTDGYAFPETFYLGAKKSREVIFFVMRDACIDGDLSIPEAVEVVHDMFARNAIHFYKLSSVSNDVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_402258

• Blastp: Protein fluG from Aspergillus with 37.84% of identity
• Blastx: Protein fluG from Aspergillus with 37.84% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN4819.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433703.1)
• Pfam: Amidohydrolase (PF04909.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;