Protein coding transcript 90978

• Transcript: Ll_transcript_403972
• CDS coordinates: 109-465 (+)
• Peptide sequence: MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVLPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGIIFS*
• ORF Type: complete

Annotations of Ll_transcript_403972

• Blastp: 60S ribosomal protein L23 from Arabidopsis with 98.25% of identity
• Blastx: 60S ribosomal protein L23 from Arabidopsis with 98.25% of identity
• Eggnog: Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome (By similarity)(COG0093)
• Kegg: Link to kegg annotations (AT1G04480)
• CantataDB: Link to cantataDB annotations (CNT0002435)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007162592.1)
• Pfam: Ribosomal protein L14p/L23e (PF00238.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;