Protein coding transcript 9099

• Transcript: Ll_transcript_340372
• CDS coordinates: 1888-2619 (+)
• Peptide sequence: MLLSVNRKHADYASFKPERRPVEKSEQPSVHSANEVRSSKTLEVAEIYKPSVHVNPIFSSVGADTGKLYSASEAHDIVFEYIEKQNLVKPTNKSIVVLDAILCDALFKGVIKKGTTYPTEIHKKDLGTAFVSRMQPHHVVTRGNESMVRKGGLKPIQLLTERRQGNKKVTKLSGIESFLMDADALASELQKKFACSTTVGELPGISWSLQTESCILVCACYIQEIHDWFIFIHQCYVTNGQGH*
• ORF Type: complete

Annotations of Ll_transcript_340372

• Blastp: Eukaryotic translation initiation factor 2D from Oryctolagus with 26.16% of identity
• Blastx: Eukaryotic translation initiation factor 2D from Rattus with 39.74% of identity
• Eggnog: translation Initiation Factor(ENOG410XSAV)
• Kegg: Link to kegg annotations (100345187)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449555.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;