Transcript | Ll_transcript_403998 |
---|---|
CDS coordinates | 275-1699 (+) |
Peptide sequence | MASVQFMWSCTQFNINHGCIRIIKPNMKPNRCSMKRCLVRCEGSNDKVPNEEKNEKKKLRVLIAGGGIGGLVLALAAKKRGHEVKVFEKDLSAVRGEGRDRGAIQLLSGALAVLEAIDGNVAKQIMEEGCVTGNRTNGLADGLSGEWFTRFDFFTPARRRGLPITLVICRIALQDILVNAVGSNILRNKAKVVDFIQEPSKVRVVLENGEHYDGDILVGADGIWSEVRSKLFGWQEANYSGFTCYTGLTHYVPPYIDTIGYRVFLGLNQYFVASDIGNGKMQWYAFQGEAPSSAPTLEGKNKKKRVLELFGKWCNDVVTLISETPEHEILQRNIYDRDMISTWGIGRVTLVGDAAHPMQPNLGQGGCMAIEDCYQLILELDKVAKHGYGESEVIPALRRYEKKRVPRVMIMHTATRMASQMVVNYKPYIEFNFWPLSILKNMQIKHPGIVISSAFLEFIFPQFADWMLAGHGLL* |
ORF Type | complete |
Blastp | Zeaxanthin epoxidase, chloroplastic from Oryza sativa with 56.32% of identity |
---|---|
Blastx | Zeaxanthin epoxidase, chloroplastic from Oryza sativa with 55.33% of identity |
Eggnog | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen(COG0654) |
Kegg | Link to kegg annotations (4335984) |
CantataDB | Link to cantataDB annotations (CNT0002155) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464986.1) |
Pfam | FAD binding domain (PF01494.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer