Protein coding transcript 91001

• Transcript: Ll_transcript_403989
• CDS coordinates: 275-799 (+)
• Peptide sequence: MASVQFMWSCTQFNINHGCIRIIKPNMKPNRCSMKRCLVRCEGSNDKVPNEEKNEKKKLRVLIAGGGIGGLVLALAAKKRGHEVKVFEKDLSAVRGEGRDRGAIQLLSGALAVLEAIDGNVAKQIMEEGCVTGNRTNGLADGLSGEWYVLFLSLSLKPTCLLPTKCWSSGIRSR*
• ORF Type: complete

Annotations of Ll_transcript_403989

• Blastp: Zeaxanthin epoxidase, chloroplastic from Arabidopsis with 58.21% of identity
• Blastx: Zeaxanthin epoxidase, chloroplastic from Lycopersicon with 52.78% of identity
• Eggnog: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen(COG0654)
• Kegg: Link to kegg annotations (AT5G67030)
• CantataDB: Link to cantataDB annotations (CNT0002036)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014493113.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;