Protein coding transcript 9101

• Transcript: Ll_transcript_340374
• CDS coordinates: 1888-2619 (+)
• Peptide sequence: MLLSVNRKHADYASFKPERRPVEKSEQPSVHSANEVRSSKTLEVAEIYKPSVHVNPIFSSVGADTGKLYSASEAHDIVFEYIEKQNLVKPTNKSIVVLDAILCDALFKGVIKKGTTYPTEIHKKDLGTAFVSRMQPHHVVTRGNESMVRKGGLKPIQLLTERRQGNKKVTKLSGIESFLMDADALASELQKKFACSTTVGELPGKKGHEVLIQGGVIDDLAKHLIEQYGVPKRYIEVLDKTRK*
• ORF Type: complete

Annotations of Ll_transcript_340374

• Blastp: Eukaryotic translation initiation factor 2D from Homo with 30.2% of identity
• Blastx: Eukaryotic translation initiation factor 2D from Rattus with 39.74% of identity
• Eggnog: translation Initiation Factor(ENOG410XSAV)
• Kegg: Link to kegg annotations (1939)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449555.1)
• Pfam: Translation initiation factor SUI1 (PF01253.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;