Protein coding transcript 91042

• Transcript: Ll_transcript_404057
• CDS coordinates: 152-838 (+)
• Peptide sequence: MLQLSIQRVKKFNSLMPQIYALGTSHFSTAADPSSIKRNPPRVPNLIGGSFVDSKATTFIDVINPATQEVVSQVPLTTDDEFKSAVSSAKKAFSSWRKTPITTRQRVMLKFQELIRRDMDKLALNVTTEQGKTLKDAQGDVFRGLEVVEHACGMATLQMGEYVSNVSHGIDTYSIREPLGVCAGICPFNFPAMIPLWMFPVAVTCGNTFILKPSEKDPGNVFYLFSCL*
• ORF Type: complete

Annotations of Ll_transcript_404057

• Blastp: Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Arabidopsis with 80% of identity
• Blastx: Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Arabidopsis with 80% of identity
• Eggnog: Dehydrogenase(ENOG410XNP1)
• Kegg: Link to kegg annotations (AT2G14170)
• CantataDB: Link to cantataDB annotations (CNT0002283)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423864.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;