Protein coding transcript 9112

• Transcript: Ll_transcript_340222
• CDS coordinates: 24-1130 (+)
• Peptide sequence: MASFSSLLFQTLILFAVISAVTPCPPSDRAALLAFRAALTEPYMGIFNSWSGYNCCQGWYGVTCDPTTYRVTDITLRGDPSEKNLQNLRRSSGFMTGNISPEICNMDNLTTLVVADWKSISGEIPSCITSLSLIRILDLSGSQISGNIPVDIGKLQRLAVLNLGDNAISGEIPASIVDLAGLMHLDLANNKISGELPTDFGKLSMLSRALLSQNNLTGSIPNSISQMNRLADLDLSMNRFTGSIPVEFGQMKVLSILKLDSNSLSGQIPSTLLNNAGMGILNLSRNGFEGTIPDVFCAKSYFMALDLSFNKLAGRIPGSLSATRFIGHLDVSHNHLCGTIPIGAPFDHLDEVSFSNNDCLCGNPLKTC*
• ORF Type: complete

Annotations of Ll_transcript_340222

• Blastp: DNA damage-repair/toleration protein DRT100 from Arabidopsis with 60.31% of identity
• Blastx: DNA damage-repair/toleration protein DRT100 from Arabidopsis with 59.71% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G12610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451464.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;