Transcript | Ll_transcript_403398 |
---|---|
CDS coordinates | 122-1654 (+) |
Peptide sequence | MARKMLIDSEIEEGTNFDFDLFVIGAGSGGVRAARFSASFGAKVAVCELPFHPVSSETIGGVGGTCVIRGCVPKKILVYGSSFGNDIEDARNYGWELSEKVDFNWKKLLEKKTNEINRLNGIYKRLLSNAGVKLFEGEGKIVGPNEVEVTQLDGTKLSYSAKHILIATGSRAQVPDIPGQELGITSDEALSLEEFPKRAVILGGGYIAVEFASIWQGMGSTVSLVFRKELPLRGFDDEMRAVVARNLEARGVNLHPRTNLTQLIKTDDGIKVITDHGEELVADVVLFATGRAPNTKRLNLEAVGVELDNAGAIKVDEYSHTNIPSIWAVGDVTNRFNLTPVALMEGTCFAKTVFGSQPSKPDYSNIPYAVFSIPPLSVVGLSEEQAVEQANGDLLVFTSSFNPMRNTISGRQEKTVMKLVVDAETDKVLGASMCGPDAPEIMQGIAVALKFGATKAQFDSTVSSHLSSLFFVLLPSEGSGSLVGYCHMSCFTVVPCLWASPAVFIYDMLF* |
ORF Type | complete |
Blastp | Glutathione reductase, cytosolic from Pisum with 83.88% of identity |
---|---|
Blastx | Glutathione reductase, cytosolic from Pisum with 85.16% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000776) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433793.1) |
Pfam | Pyridine nucleotide-disulphide oxidoreductase (PF07992.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer