Protein coding transcript 91190

• Transcript: Ll_transcript_403375
• CDS coordinates: 1-357 (+)
• Peptide sequence: AVGDVTNRVNLTPVALMEGTCFAKTVFGGQPSKPDYGYVPYAVFSIPPLSVVGFSEEEAIEHTNGDLLVFTSTFNPMKNTISGRQEKTVMKLLVDAETDKVLGASMCGPDAPEIMQVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_403375

• Blastp: Glutathione reductase, chloroplastic from Spinacia with 83% of identity
• Blastx: Glutathione reductase, chloroplastic from Spinacia with 83.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461512.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;