Protein coding transcript 91191

• Transcript: Ll_transcript_403380
• CDS coordinates: 564-1103 (+)
• Peptide sequence: MRAVVARNLEGRGINLHPRTNLTQLIKTEDGIKVITDHGEELVADVVLFATGRAPNTKRLNLEAVGLELDNAGAIKVDEYSRTNIPSIWAVGDVTNRFNLTPVALLEGTCFAKTVFGSQPSKPDYSNIPYAVFSIPPLSVVGLSEEQAIEQANGDLLVFTSSFNPLRNTISGRQEKTVMK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_403380

• Blastp: Glutathione reductase, cytosolic from Pisum with 85% of identity
• Blastx: Glutathione reductase, cytosolic from Pisum with 85.48% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462341.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;