Transcript | Ll_transcript_402742 |
---|---|
CDS coordinates | 48-491 (+) |
Peptide sequence | METLELIDAHQTQSSSSSSSSIDSSNHPSKSPPPSSSMCLSRACRRCSTTKNNDLSTDLRLGLSISQSSHSELAFNSTPREQTYDWPPIKSILRSTLVEKQNQHRPSLFVKVYMEGIPIGRKLNLLAHHSYDGLVKALGYMFRIIIL* |
ORF Type | complete |
Blastp | Auxin-responsive protein IAA31 from Arabidopsis with 51.25% of identity |
---|---|
Blastx | Auxin-responsive protein IAA8 from Oryza sativa with 41.23% of identity |
Eggnog | Aux IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations(ENOG410YIRA) |
Kegg | Link to kegg annotations (AT3G17600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419906.1) |
Pfam | AUX/IAA family (PF02309.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer