Protein coding transcript 91262

• Transcript: Ll_transcript_402737
• CDS coordinates: 473-1021 (+)
• Peptide sequence: METLELIDAHQTQSSSSSSSSIDSNNYPSKTPPPSSSSSLCLSGVCINIGSTKKTDLSTDLRLGLSIYESSQSELAFNSTPREHSYDWPPIKSILRSTLVEKQNQHRPSLFVKVYMEGILIGRKLNLMAHHSYDGLVKALGHMFRTTILYPNSQPINYGNFHFLTYEDKEGDWLMVGDVPWE*
• ORF Type: complete

Annotations of Ll_transcript_402737

• Blastp: Auxin-responsive protein IAA31 from Arabidopsis with 52.21% of identity
• Blastx: Auxin-responsive protein IAA31 from Arabidopsis with 52.21% of identity
• Eggnog: Aux IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations(ENOG410YIRA)
• Kegg: Link to kegg annotations (AT3G17600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463380.1)
• Pfam: AUX/IAA family (PF02309.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;