Transcript | Ll_transcript_402832 |
---|---|
CDS coordinates | 412-1029 (+) |
Peptide sequence | MPLLFLALSLAKRMLTCPAAELVDGSNVLYFEQAFWRSPQKPFRQRFFMVKPCPKELKCDVELSTYAIRDMEEYKNFCDRPKDQRPQPEEVIGDIAEHLTTVELKRCSRGKRCLYEGSTPPGGFPNSWNGATYCTSELAVMKNNEIHMWDRGFDDDGNQIWGPKEGPYEFKPAPTSSFNDIFSPLNLPPPPPTERRIEGSFILQE* |
ORF Type | complete |
Blastp | Chromophore lyase CRL, chloroplastic from Arabidopsis with 76.17% of identity |
---|---|
Blastx | Chromophore lyase CRL, chloroplastic from Arabidopsis with 76.17% of identity |
Eggnog | CpeT/CpcT family (DUF1001)(ENOG410Z81Y) |
Kegg | Link to kegg annotations (AT5G51020) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416006.1) |
Pfam | CpeT/CpcT family (DUF1001) (PF06206.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer