Protein coding transcript 91281

• Transcript: Ll_transcript_402842
• CDS coordinates: 252-830 (+)
• Peptide sequence: MLTCPAAELVDGSNVLYFEQAFWRSPQKPFRQRFFMVKPCPKELKCDVELSTYAIRDMEEYKNFCDRPKDQRPQPEEVIGDIAEHLTTVELKRCSRGKRCLYEGSTPPGGFPNSWNGATYCTSELAVMKNNEIHMWDRGFDDDGNQIWGPKEGPYEFKPAPTSSFNDIFSPLNLPPPPPTERRIEGSFILQE*
• ORF Type: complete

Annotations of Ll_transcript_402842

• Blastp: Chromophore lyase CRL, chloroplastic from Arabidopsis with 76.04% of identity
• Blastx: Chromophore lyase CRL, chloroplastic from Arabidopsis with 76.17% of identity
• Eggnog: CpeT/CpcT family (DUF1001)(ENOG410Z81Y)
• Kegg: Link to kegg annotations (AT5G51020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416006.1)
• Pfam: CpeT/CpcT family (DUF1001) (PF06206.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;