Protein coding transcript 914

• Transcript: Ll_transcript_290366
• CDS coordinates: 1-696 (+)
• Peptide sequence: PKAQNKNTKMKVVYFIFALLALACSIAFSYDPSPLQDFCVAINDTRSGVFVNGKFCKDLKLATAEDFFFPGLGPGNTLNPLGSKVTPVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVVEGTLYVGFVTSNQDNNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSYPPISDEVLAKAFQVDKNLIDYLQKQFWSNNS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_290366

• Blastp: Germin-like protein subfamily 1 member 7 from Arabidopsis with 72.17% of identity
• Blastx: Germin-like protein subfamily 1 member 13 from Arabidopsis with 66.98% of identity
• Eggnog: nutrient reservoir activity(ENOG410YERY)
• Kegg: Link to kegg annotations (AT3G05950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420851.1)
• Pfam: Cupin (PF00190.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;