Transcript | Ll_transcript_290366 |
---|---|
CDS coordinates | 1-696 (+) |
Peptide sequence | PKAQNKNTKMKVVYFIFALLALACSIAFSYDPSPLQDFCVAINDTRSGVFVNGKFCKDLKLATAEDFFFPGLGPGNTLNPLGSKVTPVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVVVEGTLYVGFVTSNQDNNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSYPPISDEVLAKAFQVDKNLIDYLQKQFWSNNS* |
ORF Type | 5prime_partial |
Blastp | Germin-like protein subfamily 1 member 7 from Arabidopsis with 72.17% of identity |
---|---|
Blastx | Germin-like protein subfamily 1 member 13 from Arabidopsis with 66.98% of identity |
Eggnog | nutrient reservoir activity(ENOG410YERY) |
Kegg | Link to kegg annotations (AT3G05950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420851.1) |
Pfam | Cupin (PF00190.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer