Protein coding transcript 91407

• Transcript: Ll_transcript_403137
• CDS coordinates: 765-1202 (+)
• Peptide sequence: MIAFVLSREVPVTFEKVSKLLAVMYVVSASSEQFSLSSFSKVLGENCWASYFHQASIGTHLTYRFLSNLSGRYKVQPPLDDEAYLHAYKYKEFYPWVLLYMLTFGKQKHQLLVWQFEISLVNLCSHHYPYFSENCYLFIASLMLN*
• ORF Type: complete

Annotations of Ll_transcript_403137

• Blastp: Separase from Arabidopsis with 52.44% of identity
• Blastx: Hydroxyproline O-galactosyltransferase HPGT2 from Arabidopsis with 75.64% of identity
• Eggnog: extra spindle pole bodies homolog 1 (S. cerevisiae)(COG5155)
• Kegg: Link to kegg annotations (AT4G22970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458880.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;