Transcript | Ll_transcript_403137 |
---|---|
CDS coordinates | 765-1202 (+) |
Peptide sequence | MIAFVLSREVPVTFEKVSKLLAVMYVVSASSEQFSLSSFSKVLGENCWASYFHQASIGTHLTYRFLSNLSGRYKVQPPLDDEAYLHAYKYKEFYPWVLLYMLTFGKQKHQLLVWQFEISLVNLCSHHYPYFSENCYLFIASLMLN* |
ORF Type | complete |
Blastp | Separase from Arabidopsis with 52.44% of identity |
---|---|
Blastx | Hydroxyproline O-galactosyltransferase HPGT2 from Arabidopsis with 75.64% of identity |
Eggnog | extra spindle pole bodies homolog 1 (S. cerevisiae)(COG5155) |
Kegg | Link to kegg annotations (AT4G22970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458880.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer