| Transcript | Ll_transcript_403104 |
|---|---|
| CDS coordinates | 793-1197 (+) |
| Peptide sequence | MMILQQVSKLLAVMYVVSASSEQFSLSSFSKVLGENCWASYFHQASIGTHLTYRFLSNLSGRYKVQPPLDDEAYLHAYKYKEFYPWVLLYMLTFGKQKHQLLVWQFEISLVNLCSHHYPYFFRKLLPFHCVFDA* |
| ORF Type | complete |
| Blastp | Separase from Arabidopsis with 46.48% of identity |
|---|---|
| Blastx | - |
| Eggnog | extra spindle pole bodies homolog 1 (S. cerevisiae)(COG5155) |
| Kegg | Link to kegg annotations (AT4G22970) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425826.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer