Protein coding transcript 91414

• Transcript: Ll_transcript_403110
• CDS coordinates: 793-1200 (+)
• Peptide sequence: MMILQQVSKLLAVMYVVSASSEQFSLSSFSKVLGENCWASYFHQASIGTHLTYRFLSNLSGRYKVQPPLDDEAYLHAYKYKEFYPWVLLYMLTFGKQKHQLLVWQFEISLVNLCSHHYPYFSENCYLFIASLMLN*
• ORF Type: complete

Annotations of Ll_transcript_403110

• Blastp: Separase from Arabidopsis with 46.48% of identity
• Blastx: Hydroxyproline O-galactosyltransferase HPGT2 from Arabidopsis with 75.64% of identity
• Eggnog: extra spindle pole bodies homolog 1 (S. cerevisiae)(COG5155)
• Kegg: Link to kegg annotations (AT4G22970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458880.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;