Protein coding transcript 91485

• Transcript: Ll_transcript_449495
• CDS coordinates: 1720-2232 (+)
• Peptide sequence: MLVHLFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFGWKVGPALACGNTIVLKTAEQTPLSALFASKLLHEAGLPPGVLNIVSGFGPTAGAAIATHMDVDKIAFTGSTATGRIVLELAARSNLKTVTLELGGKSPFIVCEDADVDKAVELAHFAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_449495

• Blastp: Aldehyde dehydrogenase family 2 member B7, mitochondrial from Arabidopsis with 84.21% of identity
• Blastx: Aldehyde dehydrogenase family 2 member B7, mitochondrial from Arabidopsis with 69.39% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT1G23800)
• CantataDB: Link to cantataDB annotations (CNT0001913)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424457.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;