Protein coding transcript 91689

• Transcript: Ll_transcript_449921
• CDS coordinates: 601-984 (+)
• Peptide sequence: MTTHQIDNCTEGCVVLARTKEYCSVFHGKIRDKMVKKLYLALAVSPLPIGIITHYMRPTNMAPRLVSEDFIKGWQICQLEVMECNQVPWPTTVIQDKYCIEDCEWPSKDYAYECKIKLLTGRTHQVY*
• ORF Type: complete

Annotations of Ll_transcript_449921

• Blastp: RNA pseudouridine synthase 6, chloroplastic from Arabidopsis with 72.8% of identity
• Blastx: RNA pseudouridine synthase 6, chloroplastic from Arabidopsis with 73.68% of identity
• Eggnog: pseudouridine synthase activity(COG0564)
• Kegg: Link to kegg annotations (AT4G21770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418853.1)
• Pfam: RNA pseudouridylate synthase (PF00849.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;