Protein coding transcript 91703

• Transcript: Ll_transcript_451507
• CDS coordinates: 1100-1423 (+)
• Peptide sequence: MGGLACTLSPSRKNQLVLKGKLRKNFFNLCSRLPRIFTLAIPLTERKLPHFHHYQHGVARFQPVVPSTPTPQITSSEEVENGFINATFGPGCHRMSGVRYGCRRWLR*
• ORF Type: complete

Annotations of Ll_transcript_451507

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 33.1% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420682.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;