Protein coding transcript 91820

• Transcript: Ll_transcript_449397
• CDS coordinates: 674-1096 (+)
• Peptide sequence: MDPNELLVQECDVLMPCALGGVLNKDNAADVKAKFIVEAANHPTDPDADEILSKKGVIILPDIYANAGGVTVSYFEWVQNIQGFMWDEEKVNHELKKYMTNAFQDIKKMCKTHNCDLRMGAFSLGLNRVAHATLLRGWEA*
• ORF Type: complete

Annotations of Ll_transcript_449397

• Blastp: Glutamate dehydrogenase from Vitis with 83.57% of identity
• Blastx: Glutamate dehydrogenase 2 from Arabidopsis with 81.77% of identity
• Eggnog: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor(COG0334)
• Kegg: Link to kegg annotations (100257914)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423919.1)
• Pfam: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (PF00208.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;