Protein coding transcript 91821

• Transcript: Ll_transcript_449398
• CDS coordinates: 175-780 (+)
• Peptide sequence: MNALAATNRNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCNARDLSLSELERLTRVFTQKIHDLIGVQRDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLGREAATGLGVIFFFFFLFAEYGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_449398

• Blastp: Glutamate dehydrogenase 2 from Arabidopsis with 90.1% of identity
• Blastx: Glutamate dehydrogenase 2 from Arabidopsis with 90.1% of identity
• Eggnog: oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor(COG0334)
• Kegg: Link to kegg annotations (AT5G07440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421216.1)
• Pfam: Glu/Leu/Phe/Val dehydrogenase, dimerisation domain (PF02812.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;