Protein coding transcript 91917

• Transcript: Ll_transcript_451342
• CDS coordinates: 189-584 (+)
• Peptide sequence: MKEKENIKNFDNAEADTFTISEIPKSPPPQSPLFSIFQPSIMANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVIVEKLGDPTQGYEDFTASLPADECRYAVYDFEYLTEGNVPKSRIFFVAW*
• ORF Type: complete

Annotations of Ll_transcript_451342

• Blastp: Actin-depolymerizing factor 1 from Petunia with 81.11% of identity
• Blastx: Actin-depolymerizing factor 2 from Petunia with 80% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440082.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;