Protein coding transcript 91920

• Transcript: Ll_transcript_451355
• CDS coordinates: 189-668 (+)
• Peptide sequence: MKEKENIKNFDNAEADTFTISEIPKSPPPQSPLFSIFQPSIMANAASGMAVHDDCKLRFMELKAKRTHRFIVYKIEEKQKQVIVEKLGDPTQGYEDFTASLPADECRYAVYDFEYLTEGNVPKSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_451355

• Blastp: Actin-depolymerizing factor 1 from Petunia with 84.03% of identity
• Blastx: Actin-depolymerizing factor 1 from Petunia with 84.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440082.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;