| Transcript | Ll_transcript_451358 |
|---|---|
| CDS coordinates | 121-429 (+) |
| Peptide sequence | MQAPKGRFKRDPDGIQTEFQATDPTEMGLRVVLVELERIYELMLERLREKVVWDFAFGLRRTLAILVTGKVVKEEASPCVMELELENTFMLMLMLMIMLILV* |
| ORF Type | complete |
| Blastp | Actin-depolymerizing factor 2 from Arabidopsis with 72.41% of identity |
|---|---|
| Blastx | Actin-depolymerizing factor 2 from Petunia with 72.41% of identity |
| Eggnog | actin-depolymerizing factor(ENOG41122P5) |
| Kegg | Link to kegg annotations (AT3G46000) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454163.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer