Protein coding transcript 91924

• Transcript: Ll_transcript_451348
• CDS coordinates: 1364-1681 (+)
• Peptide sequence: MSLFICLSSVSAKSFLYFNHVSAILQANAASGMAVHDDCKLRFLELKTKRAHRFIVFKIEEKQKQVVVEKLGEPAQGYEDFTASLPADECRYAVYDFEFLTEGNVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_451348

• Blastp: Actin-depolymerizing factor 4 from Arabidopsis with 82.05% of identity
• Blastx: Actin-depolymerizing factor 4 from Arabidopsis with 82.05% of identity
• Eggnog: actin-depolymerizing factor(ENOG41122P5)
• Kegg: Link to kegg annotations (AT5G59890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006586815.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;