Protein coding transcript 92

• Transcript: Ll_transcript_523364
• CDS coordinates: 2-448 (+)
• Peptide sequence: DVAVNAPTAGVILEFLANEEDNVVVGQDLVKIDAGAQASESGATKAKEEPKEAASESKETSSQPQGQKEESKPAQEEKKPEQPKEQPKQESKPAPEPKQEKKPEKKPEAEESKPTAPGSREERRVKMNRMRLRIAERLKQSQNTAASLT
• ORF Type: internal

Annotations of Ll_transcript_523364

• Blastp: Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial from Schizosaccharomyces with 43.37% of identity
• Blastx: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial from Saccharomyces with 84.85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC776.15c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003593015.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;