Protein coding transcript 920

• Transcript: Ll_transcript_482003
• CDS coordinates: 1-408 (+)
• Peptide sequence: QPNQPRQKTKRIHKHGKSPAKIRTVFNLRILAVELNKHRKPDPDPRPKSSNMSKEFTANDVKEAGSVDKGLHIIIDNNVYKMDGFVEEHPGGAKILKRVGGKDASKQFWKYHNESVLKKYQERLKVGTLKESAKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_482003

• Blastp: Putative cytochrome b5 B11H24.095 from Neurospora with 59.52% of identity
• Blastx: Putative cytochrome b5 B11H24.095 from Neurospora with 59.52% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (NCU03603)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003604969.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;